Wordy Wednesday 584: Snake Crisscross 27

WORDY WEDNESDAY #582
TOUCHWORD 30 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cindy Heisler **
Cole Kendall **
Derek Allen **
James Haddad **
Joe Bernard **
Michael Lebowitz **
Randy Rogers **
Kevin Orfield **
Patrick Jordan **
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #583
DIV IDE DIN TOT RIP LES 15 (hint)
As of this writing, 12 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #584
SNAKE CRISSCROSS 27
(click here for a PDF version)
This puzzle contains a word suggested by patron Cathy Bowen. Support me on Patreon at the Super Fan level ($5/month) and solve the monthly Patron Puzzle for a chance to suggest a seed word for a future puzzle, or at the Ultra Fan level ($20/month) to suggest one seed word every month!
This puzzle’s crisscross grid contains entries which read across and down as normal; these are defined in alphabetical order by length under the heading “Crisscross Words”. The grid also needs to be divided into a number of areas which follow a single clear path, called “snakes”. Each of these snakes contains an entry reading from one end of the path to the other; these are defined in alphabetical order by length under the heading “Snake Words”. You must determine how the grid is divided into snakes and which entry corresponds to each snake.

Arrange the letters in the highlighted cells to form the final answer, a Scrabble-legal (unhyphenated, uncapitalized, etc.) 8-letter word.
CRISSCROSS WORDS
3 LETTERS

Sheet used by an animator
Prominent shark feature
Handgun, slangily
____ the Science Kid (PBS Kids series)
Turf
4 LETTERS
Gatherings of comic book fans or of furries, briefly
Jane ____ (Charlotte Brontë novel)
Ctrl+Y function, often
Horse rider’s strap
Loose-fitting outer garment
Soft mineral
“____ shalt have no other gods. . .”
Ensnare
5 LETTERS
Something of value
1994 action flick erroneously referred to by Homer Simpson as “The Bus That Couldn’t Slow Down”
Recurring motif
6 LETTERS
More than just request
A type of printer
United States ____ Service
Talked back
7 LETTERS
Gospel singer and vocal band leader Bill
8 LETTERS
The ordinate’s counterpart in Cartesian coordinates
10 LETTERS
Finds through careful searching: 2 wds.
With “The”, pro wrestler Mark William Calaway’s ring name
SNAKE WORDS
5 LETTERS

Over
Abrasive mineral
Style of abstractionism that uses visual illusions: 2 wds.
Not fresh
6 LETTERS
University of Texas Permian Basin’s city
7 LETTERS
Pine, for one
Williams who designed the King’s Quest series of adventure games
Member of a jazz orchestra
“____ lies the problem”
8 LETTERS
They stand the test of time
9 LETTERS
Geographical region once linked to the Confederacy: 2 wds.
10 LETTERS
Baseball great known as Captain Clutch: 2 wds.
11 LETTERS
Short-legged hare-hunting dog breed: 2 wds.

COMING NEXT WEEK. . .
* What's a 5-letter word for "Actor Kagasoff of The Secret Life of The American Teenager"?

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 8: "Ken" You Solve This?

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 2 (Hopefully Not "Sew" Hard): puzzle PDF, hint PDF
* 21 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 3 (Color My World): puzzle PDF, hint PDF
* 20 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 4 (Another Baseball Baffler): puzzle PDF, hint PDF
* 19 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 5 (Confusing Columns): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 6 (Arcane Archipelago): puzzle PDF, hint PDF
* 15 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 7 (Work Your Magic): puzzle PDF, hint PDF (new!)
* 20 people solved this within the first week for 50 points apiece.  

The total number of points scored is 7300. Thus, the current money pool for the Palm Beach County Food Bank is $73.00. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $292.00. If you haven't already, you may solve the above puzzles for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 8:
"KEN" YOU SOLVE THIS?
Kevin had a dream that he was kidnapped and trapped in a square room by two men named Ken (or maybe Tom). Luckily, Kevin was able to escape by exercising his math skills!

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 8's hint and Episode 9's puzzle, a meta requiring the 8 previous answers to be solved. Good luck!

Wordy Wednesday 583: DIV IDE DIN TOT RIP LES 15

WORDY WEDNESDAY #581
GIBBERISH GENIUS 2 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Cathy Bowen **
Cole Kendall **
Derek Allen **
Michael Lebowitz **
Pavel Curtis **
Randy Rogers **
Kevin Orfield **
Luk Weyens **
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #582
TOUCHWORD 30 (hint)
As of this writing, 13 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #583
DIV IDE DIN TOT RIP LES 15
(click here for a PDF version)
(click here for rules)
This puzzle contains a word suggested by patron M. Sean Molley. Support me on Patreon at the Super Fan level ($5/month) and solve the monthly Patron Puzzle for a chance to suggest a seed word for a future puzzle, or at the Ultra Fan level ($20/month) to suggest one seed word every month!
  __ __ __ __    __ __ __ __    __ __ __
          ^           ^           ^
  __ __ __ __ __ __ __ __ __ __ __ __ __ __    __ __ __    __ __ __ __    __ __
    ^        ^        ^        ^        ^           ^           ^           ^
 *__ __ __ __ __ __ __ __ __ __ __ __,  *__ __ __ __ __   *__ __ __ __ __ __,
       ^        ^        ^        ^           ^        ^           ^        ^
  __ __ __    __ __ __    __    __ __ __ __ __ __    __ __ __ __ __ __ __
          ^           ^              ^        ^           ^        ^
  __ __ __ __ __ __ __?
    ^        ^
__ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __
01 02 03    04 05 06    07 08 09    10 11 12    13 14 15    16 17 18    19 20 21
__ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __
22 23 24    25 26 27    28 29 30    31 32 33    34 35 36    37 38 39    40 41 42
__ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __
43 44 45    46 47 48    49 50 51    52 53 54    55 56 57    58 59 60    61 62 63
__ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __    __ __ __
64 65 66    67 68 69    70 71 72    73 74 75    76 77 78    79 80 81    82 83 84

____ shirt (Hawaiian shirt) __ __ __ __ __
                            78 30 33 75 83
Scorpion or spider, for example __ __ __ __ __ __ __ __
                                10 18 27 41 77 24 57 15
“Can’t ____ This Feeling” (REO Speedwagon hit) __ __ __ __ __
                                               02 40 28 05 74
One who studies past events __ __ __ __ __ __ __ __ __
                            34 08 54 67 51 03 23 13 56
Car manufacturer named after a wild spotted cat __ __ __ __ __ __
                                                50 16 68 70 35 21
New York City detective voiced by James     __ __ __ __ __ __ __ __
  McCaffrey in a video game trilogy: 2 wds. 11 01 79 63 38 82 46 25
Company with its logo on a race car, for example __ __ __ __ __ __ __
                                                 48 45 69 14 64 59 61
Super Mario ____ (2002 Nintendo GameCube __ __ __ __ __ __ __ __
  game set on a tropical island)         53 20 49 32 37 06 72 60
Destructive whirlwind __ __ __ __ __ __ __
                      80 66 58 36 07 22 52
Available to be taken by anyone: 3 wds. __ __ __ __ __ __ __ __ __ __
                                        73 84 44 17 09 31 71 04 65 39
Gardener’s conveyance __ __ __ __ __ __ __ __ __ __ __
                      26 29 47 12 43 19 42 81 55 62 76


COMING NEXT WEEK. . .
* What's a 10-letter, 2-word answer "Baseball great known as Captain Clutch"?

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 7: Work Your Magic

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 2 (Hopefully Not "Sew" Hard): puzzle PDF, hint PDF
* 21 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 3 (Color My World): puzzle PDF, hint PDF
* 20 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 4 (Another Baseball Baffler): puzzle PDF, hint PDF
* 19 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 5 (Confusing Columns): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 6 (Arcane Archipelago): puzzle PDF, hint PDF (new!)
* 15 people solved this within the first week for 50 points apiece.
 
The total number of points scored is 6250. Thus, the current money pool for the Palm Beach County Food Bank is $62.50. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $250.00. If you haven't already, you may solve the above puzzles for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 7:
WORK YOUR MAGIC
Kevin’s favorite magic trick is turning words into other words by rearranging their letters; his second favorite is arranging numbers to make their sums equal in every row and every column.
1. ____ finger
2. Furniture store offering
3. Vigilant
4. ____ Day (September holiday)
5. Perfect
6. Stitch of Lilo & Stitch is one
7. Musical symbols
8. Hollow rock with a crystal-lined interior
9. “Home on the ____”
10. Ahead of schedule
11. Arm joint
12. Rich German cake
13. Brick of metal
14. Titles
15. Gather, as grain or information
16. Sesame Street’s grouchy resident
17. Word puzzle using pictures
18. Blazing
19. Metalworking tool
20. Boléro composer
21. Enthusiastic
22. Murder, She ____ (1984-1996 TV series)
23. Certain heron
24. Jumped
25. Jouster’s need

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 7's hint and Episode 8's puzzle. Good luck!

Patron Puzzles for Philanthropy: Anacrossword Twenty-Pack Three

This update to the Patron Puzzles for Philanthropy initiative is to announce Anacrossword Twenty-Pack Three!
Artwork by Tintinabar

This pack contains 20 Anacrossword puzzles for the price of US$10, and is, as the title suggests, a sequel to the Anacrossword Twenty-Pack and Anacrossword Twenty-Pack Two. Anacrosswords are a recurring puzzle on this blog, inspired by a concept seen in Games magazine eons ago. Combining crosswords and acrostic puzzles, when the letters in the crossword are transferred to the correspondingly-numbered blanks, each of these puzzles yields a quote followed by its author (as opposed to the ones on this blog which yield a clue to a final answer). Each puzzle comes in a hard version (in which the solver must determine where each answer goes, as well as where spaces and punctuation belong in the quote) and an easy version (in which these things are given to the solver). Puzzles vary in size from 50 blanks in the smallest puzzle to 167 blanks in the largest puzzle.

As a reminder, this is a charity initiative. Please e-mail me (glmathgrantATgmailDOTcom) a copy of your charitable receipt to my local food bank, the Food Bank of West Central Texas, to receive this puzzle pack. (It must be a new donation, dated no earlier than one day before you email me.) Click here for a list of all of the puzzle packs in this initiative. Happy solving!

Wordy Wednesday 582: Touchword 30

WORDY WEDNESDAY #580
PENT WORDS 116 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cindy Heisler **
Derek Allen **
James Haddad **
Joe Bernard **
Michael Lebowitz **
Pavel Curtis **
Randy Rogers **
Kevin Orfield **
Patrick Jordan *
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #581
GIBBERISH GENIUS 2 (hint)
As of this writing, 10 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #582
TOUCHWORD 30
(click here for a PDF version)
In a crossword, words cross each other; in this puzzle, they merely touch. More specifically, all answers read across, and every letter shares an edge with at least one identical letter either immediately above or immediately below. The top and bottom rows are considered adjacent. (If you want more of these puzzles, the author offers the Touchword subscription service Outside the Fox Puzzles.) Arrange the letters in the shaded squares to form the final answer, a Scrabble-legal (unhyphenated, uncapitalized, etc.) 8-letter word.
1 F. Scott Fitzgerald’s wife after whom a video game princess is named / Avatar: The Way of ____ / Inputs a phone number
2 Persisted: 2 wds. / Saturday Night Live alum Cheri / Do nothing
3 Common greeting / Part of Pinocchio that grows / With “The”, 1984 Nik Kershaw song covered by Gigi D’Agostino in 1999
4 Flat-shelled marine mollusk / Vociferous
5 Unawares / Star Trek: The ____ Generation / Ted of The Amboy Dukes
6 It records flight data in the event of a crash: 2 wds. / Fabric softener brand with a teddy bear mascot
7 Dark and desolate / Constricting snakes / Squirm
8 1928 animated short film that entered the public domain in 2024: 2 wds.
9 Ladder rung / ____ Lisa Smile (2003 film) / Structure for climbing plants
10 Surname of an infamous 1994 murder trial defendant / Rash
11 Weaklings / Isaac who voiced Gomez in The Addams Family (2019) / Hallow
12 Chardonnay, for example / Just average: hyph. / Edible fowl viscera
13 Straightforward / Boo-Boo Bear’s companion / Decline
14 Establishment with books that can be checked out / ____ butter / Ace of ____ (Swedish pop group)
15 Marty of Madagascar is one / Did laundry / Lance of NSYNC

COMING NEXT WEEK. . .
* What's an 8-letter, 2-word answer for "New York City detective voiced by James McCaffrey in a video game trilogy"?
* Patron Puzzle #117, which will be delivered on February 8, 2024, exclusively to Patreon supporters at the Super Fan level and up ($5 or more per month), is a Framelinks.

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 6: Arcane Archipelago

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 2 (Hopefully Not "Sew" Hard): puzzle PDF, hint PDF
* 21 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 3 (Color My World): puzzle PDF, hint PDF
* 20 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 4 (Another Baseball Baffler): puzzle PDF, hint PDF
* 19 people solved this within the first week for 50 points apiece; 2 people solved it later for 25 points.
Episode 5 (Confusing Columns): puzzle PDF, hint PDF (new!)
* 23 people solved this within the first week for 50 points apiece.
 
The total number of points scored is 5500. Thus, the current money pool for the Palm Beach County Food Bank is $55.00. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $218.00. If you haven't already, you may solve the above puzzles for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 6:
ARCANE ARCHIPELAGO
Kevin recently vacationed at a chain of small islands. Naturally, the visit was rendered unnecessarily frustrating by the fact that the map of the islands was made into a puzzle.

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 6's hint and Episode 7's puzzle. Good luck!

Wordy Wednesday 581: Gibberish Genius 2

WORDY WEDNESDAY #579
FRAMELINKS 21 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cindy Heisler **
Derek Allen **
James Haddad **
Michael Lebowitz **
Pavel Curtis **
Randy Rogers *
Kevin Orfield **
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #580
PENT WORDS 116 (hint)
As of this writing, 10 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #581
GIBBERISH GENIUS 2
(click here for a PDF version)
This puzzle contains a word suggested by patron Randy Rogers. Support me on Patreon at the Super Fan level ($5/month) and solve the monthly Patron Puzzle for a chance to suggest a seed word for a future puzzle, or at the Ultra Fan level ($20/month) to suggest one seed word every month!
Are you gifted enough to grapple with this gobbledygook again?
ALTESNATIVETOPAPESOSSCISSOSS
BRIEISHELEVAEOR
COLORFULYPATERNEHANKERCHIEFCOMONLYWORNONTHEHEA
DNCETHTORIGINTEDINBOHEMI
EBEAVERSUBUILDHTHEM
EOPPOSITEFOFEFORENINLNAUTICALYTERMINOLOGY
FMOUSAUUSFLMILLMDRECTORIOORSIELBERGPRRG
GATHARINGCATTLAORSHAAP
GIONNTWEBSITETHONTHONSONUCTIONS
HTSEQUAKSSMARSSTIMDSSACCELERATINNS
LAUNDRYUREDETERGENTUREBRANDURE
NOTORIOUASSASSIJOHWILKE
OSERIESOOFOMOUNTAINS
PHILOOPHYINPIEDBYGEMANCOMMUNITKAL
PLITICALDAMASARRINGKRRYWSHINGTONAOIVIAPPE
PRAYRRTHNTMIGUTPRECEQEDINNRR
SECOREOEFZEEROIENGEOLF
VIFEOHTUSANDOWTNUHDREDGIEHTYEEFT

Alphabetize by category:
_______________(2,vii)
_______________(4,iv)
_______________

_______________
_______________
_______________(3,viii)
_______________(3,i)

_______________
_______________(2,vi)
_______________
_______________
_______________(2,v)

_______________(3,iii)
_______________
_______________(2,ii)
_______________
_______________
_______________

COMING NEXT WEEK. . .
* What's a 15-letter, 2-word answer for "1928 animated short film that entered the public domain in 2024"?

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 5: Confusing Columns

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 2 (Hopefully Not "Sew" Hard): puzzle PDF, hint PDF
* 21 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 3 (Color My World): puzzle PDF, hint PDF
* 20 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 4 (Another Baseball Baffler): puzzle PDF, hint PDF (new!)
* 19 people solved this within the first week for 50 points apiece.

The total number of points scored is 4150. Thus, the current money pool for the Palm Beach County Food Bank is $41.50. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $166.00. If you haven't already, you may solve the above puzzles for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 5:
CONFUSING COLUMNS
This puzzle looks vaguely like one that confounded Kevin last May. Can you conquer these columns?

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 5's hint and Episode 6's puzzle. Good luck!

Wordy Wednesday 580: Pent Words 116

WORDY WEDNESDAY #578
ANACROSSWORD 37 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cindy Heisler **
Derek Allen **
Michael Lebowitz **
Nan **
Pavel Curtis **
Randy Rogers *
Kevin Orfield **
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #579
FRAMELINKS 21 (hint)
As of this writing, 11 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #580
PENT WORDS 116
(click here for a PDF version)
In this puzzle, you must divide the grid into pentominoes (regions containing five cells each), and write a letter in each cell. The rows, reading from left to right, will contain the words hinted at by the Across clues. The letters in the pentominoes, in reading order (left to right starting with the top row), will form the words hinted at by the Pentominoes clues; these clues are presented in no particular order. (In the example, the rows spell PLANT, SHARE, and BITES, and the pentominoes spell the words PLANS, TREES, and HABIT.) Use the ACROSS answers to determine where the pentominoes are.
ACROSS (two answers per row):
1 Deceptive act / Big name in lighters and pens
2 Frankenstein author Mary / Spigot in a cask
3 Long, blunt-ended cigar / ____ Straits (“Walk of Life” band)
4 Marks on a rancher’s cattle / Ask for ID
5 Nest on a cliff / Errand-running lackey
6 Male flower organ / Peru’s capital
7 Type of shellfish in Lewis Carroll’s poem The Walrus and the Carpenter / EarthBound protagonist who’s playable in the Super Smash Bros. series
8 Entreaty / ____ stick (cell phone accessory)
9 Homily / Produce a design using acid
10 ____ John, M.D. (medical drama that spun off from M*A*S*H) / Grain used in bread and whiskey
PENTOMINOES:
* HALF OF THE FINAL ANSWER
* THE OTHER HALF OF THE FINAL ANSWER
* Low point
* Sheet of microfilm in a library
* The ____ Crusader (Batman)
* Nag or Nagaina of Rikki-Tikki-Tavi, for one
* The Boy and the ____ (2023 animated film directed by Hayao Miyazaki)
* Burns lightly
* Green citrus fruits
* Painter Velázquez
* Account ledger entry
* Japanese egg noodles
* Gasoline ____ (comic by Jim Scancarelli)
* Painter Claude
* Bind, as with long pieces of leather
* Actor Daniel of Home Alone (1990)
* Rub out, as erroneous pencil marks
* Ancient Greek fabulist
* Painter’s prop
* Devour quickly, with “down”

COMING NEXT WEEK. . .
* Are you enough of a genius to contend with even more gibberish?

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 4: Another Baseball Baffler

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 2 (Hopefully Not "Sew" Hard): puzzle PDF, hint PDF
* 21 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 3 (Color My World): puzzle PDF, hint PDF (new!)
* 20 people solved this within the first week for 50 points apiece.

The total number of points scored is 3150. Thus, the current money pool for the Palm Beach County Food Bank is $31.50. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $126.00. If you haven't already, you may solve the above puzzles for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 4:
ANOTHER BASEBALL BAFFLER
Kevin recently found a childhood notebook in which he recorded the details of a series of baseball games he watched way back when.
From January 1 to January 29, Kevin watched 5 baseball games. 5 teams (the Aardvarks, the Badgers, the Cougars, the Deer, and the Elephants) played. Each team was the home team in one game and the visiting team in a different game. (No team ever played against itself.) Using the clues below, determine who was the home team and who was the visiting team on each date.

1. The home team on January 1 was the visiting team on January 29.

2. The home team on January 8 was not the visiting team on January 22.

3. The Elephants were the visiting team on January 15; their opponents were not the Cougars.

4. Neither the Cougars nor the Elephants were the home team on January 8, nor were the Deer the visiting team on that date.

5. The Aardvarks were the home team exactly three weeks before the Deer were the home team.

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 4's hint and Episode 5's puzzle. Good luck!

Wordy Wednesday 579: Framelinks 21

WORDY WEDNESDAY #577
GIBBERISH GENIUS (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cole Kendall **
Derek Allen **
James Haddad **
Michael Lebowitz **
Pavel Curtis **
Randy Rogers **
Jason Boomer **
Kevin Orfield **
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #578
ANACROSSWORD 37 (hint)
As of this writing, 10 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #579
FRAMELINKS 21
(click here for a PDF version)
Fill in the empty squares in the diagram with the given letters to form words.
Arrange the letters in the shaded squares to form the final answer, a Scrabble-legal (unhyphenated, uncapitalized, etc.) 8-letter word.

A A A A A A A A A   B B B B B B   C C C C   D D   E E E E E E E E E   G G   H   I I I I I   J   K K   M
N N   O O O O O   P P   R R R R R R R   S S S S   T T T T T T   U U   W   Y
 
COMING NEXT WEEK. . .
* What's a 5-letter word for "The Boy and the ____ (2023 animated film directed by Hayao Miyazaki)"?

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 3: Color My World

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF
* 23 people solved this within the first week for 50 points apiece; 0 people solved it later for 25 points.
Episode 2 (Hopefully Not "Sew" Hard): puzzle PDF, hint PDF (new!)
* 21 people solved this within the first week for 50 points apiece.

The total number of points scored is 2200. Thus, the current money pool for the Palm Beach County Food Bank is $22.00. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $88.00. If you haven't already, you may solve the above puzzles for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 3:
COLOR MY WORLD
While Kevin’s fur comes in many different colors, this puzzle only has fifteen. Can you find them?

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 3's hint and Episode 4's puzzle. Good luck!

Wordy Wednesday 578: Anacrossword 37

WORDY WEDNESDAY #576
SECTION SIX 57 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cindy Heisler **
Derek Allen **
Michael Lebowitz **
Pavel Curtis **
Kevin Orfield **
Ryan Faley **
Sam Levitin **
Tower **

WORDY WEDNESDAY #577
GIBBERISH GENIUS (hint)
As of this writing, 13 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #578
ANACROSSWORD 37
(click here for a PDF version)
(click here for rules)
__ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __
01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32
__ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __
33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64
__ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __
65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83

• Extremely clumsy: 2 wds.
• Bynes of Hairspray (2007)
• Phoenix-based motel chain: 2 wds.
• Prince in The Chronicles of Narnia
• Caribou, for one
• Shortage
• Inhibit
• Media franchise based on a Bandai virtual pet
• Congressional Medal of ____
• The Hoosier State’s largest city
• Anchorman
• Witherspoon of Legally Blonde (2001)
• A blade’s protective case
• Certain myrtle relative: 2 wds.

COMING NEXT WEEK. . .
* A Framelinks!

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 2: Hopefully Not "Sew" Hard

PREVIOUS EPISODES
Introduction (what these puzzles are and why they're called "Kevin's Puzzles at Home Season 6"): click here
Episode 1 (A High-Tec Puzzle): puzzle PDF, hint PDF (new!)
* 23 people solved this within the first week for 50 points apiece.

The total number of points scored is 1150. Thus, the current money pool for the Palm Beach County Food Bank is $11.50. Three anonymous benefactors have agreed to match this donation, meaning that the Palm Beach County Food Bank will actually receive $46.00. If you haven't already, you may solve the above puzzle for 25 points, possibly with the aid of the hint.

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 2:
HOPEFULLY NOT "SEW" HARD
Kevin found a quilt that his grandmother made him when he was a pup. She always kept her brain young by solving and writing puzzles; Kevin wonders if she cleverly hid a puzzle in the blocks of this quilt.

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 2's hint and Episode 3's puzzle. Good luck!

Wordy Wednesday 577: Gibberish Genius

WORDY WEDNESDAY #575
PENT WORDS 115 (answer)
Here is the answer to this puzzle. If you still wish to solve it yourself, please go here for the normal version of the puzzle, or here for the easier version of the puzzle. Here's a list of people who solved it:
Bonnie Veenschoten **
Cathy Bowen **
Cindy Heisler **
Cole Kendall **
Derek Allen **
James Haddad **
Michael Lebowitz **
Kevin Orfield **
Patrick Jordan *
Ryan Faley **
Sam Levitin **
SquishmallowsUnited **
Tower **

WORDY WEDNESDAY #576
SECTION SIX 57 (hint)
As of this writing, 10 people have solved this puzzle. Haven't solved it yet? Here's an easier version. Send your answers to glmathgrant[at]gmail[dot]com within the next week to appear on the solvers list and be recognized for your puzzle prowess. Good luck, solvers!

WORDY WEDNESDAY #577
GIBBERISH GENIUS
(click here for a PDF version)
This puzzle contains a word suggested by patron Cathy Bowen. Support me on Patreon at the Super Fan level ($5/month) and solve the monthly Patron Puzzle for a chance to suggest a seed word for a future puzzle, or at the Ultra Fan level ($20/month) to suggest one seed word every month!
Are you gifted enough to grapple with this gobbledygook?
BJECTRBITINGETWEENARSNDUPITER
CAPTACNPLAYCDCYWILLICMSHATNCR
HAVNLYCOUNRPARSOHSVNDADLYSINS
LOFFICIAEMARINLMAMMAFOAFLORID
MFAMOUSUSOUPNCANIPAINTERRWARHOL
PIIDLEIRBIXER
PRESIDENUFOLLOWINHCOOLIDGF
PRESONALJUORNAL
SBLNGOFMARONNNTENDOGAMES
SETALUMEMENIMEROEKARD
SPPROJECTILESPUSEDSPINSPARCHERY
STATEWHERENASHVIEANDCHAANGAARE
TIMEDGOARDBAMEPLAYEDONABRIDOFLETTEREDCUGES
TOBACCOTOBACCORESIDUERESIDUE
YUOUNGMUALECUHILD
__ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __ __
01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27


COMING NEXT WEEK. . .
* What media franchise is based on a Bandai virtual pet?
* Patron Puzzle #116, which will be delivered on January 8, 2024, exclusively to Patreon supporters at the Super Fan level and up ($5 or more per month), is a Fill-In Crossword.

Submit your answers to glmathgrant[at]gmail[dot]com. Until next time, happy solving!

Kevin's Puzzles at Home Season 6, Episode 1: A High-Tec Puzzle

INTRODUCTION
This series is inspired by the website Kevin's Puzzles, on which Kevin Orfield posts an instructionless puzzle-hunt-style puzzle every Monday. Kevin Orfield's puzzles usually lean towards the easy side of this genre in order to target a less experienced and/or younger audience. Kevin's Puzzles at Home is my knockoff of Kevin's Puzzles, so called because of the "we have X at home" meme:
The puzzles in Kevin's Puzzles at Home are intended to be easier than my Wordy Wednesday posts, and hopefully at least 80% as entertaining as the real Kevin's Puzzles. Kevin's Puzzles at Home will be presented by my "we have X at home" version of Kevin, a prodigious and colorful wolf named Kevin Edmund Kepler:
(This illustration by Tintinabar is not part of any puzzle. Any resemblance between this Kevin and the real Kevin, or any real Kevin, is entirely coincidental.)
 
Every Monday during January and February 2024, a new episode will be posted at 12:01 AM (Central); as with the real Kevin's Puzzles, as is the standard with other puzzle hunts, the final answer will be a word or phrase. Email me (at glmathgrant[at]gmail[dot]com) the correct solution to this puzzle within the next week to score 50 points. Each puzzle will also have a hint posted for it one week later; solving the puzzle while the hint is up will be worth 25 points. Episode 9, which will be posted on February 26, is a meta puzzle which requires the answers to all of the previous puzzles in order to be solved; this puzzle will be worth double (100 points before the hint, 50 points after). The highest possible score a solver can attain will thus be 500 points, by solving each puzzle during its first week. In an effort to aid people who don't have food at home, for every point scored by my readers by 11:59 PM (Central) on March 10, I will donate 1¢ to the Palm Beach County Food Bank, up to a maximum of $100. (Thus, each solver can contribute a maximum of $5 to this pool.) Three anonymous benefactors have agreed to match my donation as well, making the maximum possible donation $400 (and thus the maximum contribution to this donation by a single solver $20). To date, the Kevin's Puzzles at Home series has raised $1,759.50 for various food banks! A huge thank you to the solvers and anonymous benefactors who have made this impact possible!

Unlike the real Kevin's Puzzles, which posts each puzzle's solution one week after its hint is posted, all puzzle solutions will be posted simultaneously on March 11, one week after the final hint is posted. This will make the meta slightly harder, since you can't just look up the solutions to the previous puzzles to start solving it, but will also permit latecomers to score more points (and thus raise more money) than otherwise possible.

Astute readers will notice that the words "Season 6" appear in the title. Links to the previous seasons follow:
Season 1 (May-June 2022): Puzzles and hints, solutions.
Season 2 (September-October 2022): Puzzles and hints, solutions
Season 3 (January-February 2023): Puzzles and hints, solutions
Season 4 (May-June 2023): Puzzles and hints, solutions
Season 5 (September-October 2023): Puzzles and hints, solutions
 
Have fun, and remember to check out the real Kevin's creations (which go up at noon Central time every Monday) if these fake ones are up your alley!
 
Special thanks to Jason Boomer, John Bulten, and Joseph DeVincentis for testing these puzzles!

KEVIN’S PUZZLES AT HOME
SEASON 6, EPISODE 1:
A HIGH-TEC PUZZLE
Kevin is a huge fan of detective fiction, but sometimes he forgets some of the details.
Much to Kevin’s disappointment, Rex Stout’s character Nero (__) ___ ___ ___ ___ is a human being and not a canine like he is.

Due to his enormous range of knowledge, like a huge volume of reference books, boy detective Leroy Brown has the nickname “___ ___ ___ ___ ___ ___ ___ ___ ___ ___ (__) ___ Brown”.

In the 1980’s, Stephanie Zimbalist played private investigator Laura Holt on the metallically-titled television series Remington ___ (__) ___ ___ ___ ___.

Adrian ___ ___ (__) ___ is not a friar; instead, he is a detective with OCD portrayed on television by Tony Shalhoub.

Arguably the most famous fictional detective, Sir Arthur Conan Doyle’s Sherlock
___ ___ ___ ___ (__) ___ first appeared in A Study in Scarlet.

Although you might expect otherwise, teenage television detective Veronica ___ ___ ___ (__) lives on Earth and not on a red planet in our solar system.

The Maltese Falcon protagonist Sam (__) ___ ___ ___ ___ is, oddly enough, not accompanied by cohorts named Club, Diamond, and Heart.

(This illustration by Tintinabar is not part of the puzzle.)

Submit your answer to glmathgrant[at]gmail[dot]com for 50 points, and stay tuned next week for Episode 1's hint and Episode 2's puzzle. Good luck!

Blog Archive